Pfam domain
Pfam family: BpuJI_N (PF11564.10)
Uniprot AC: A3FMN7
RecName: Restriction endonuclease R.BpuJI
Begin-End: 2-274
Organism: Bacillus pumilus
Interaction Mode:  H-Bb H-Mj L-Bb L-Mj L-Mn 

Sequence:
NYNPEEQFRCTIIRGKAKNMLDNLLPAYANIIDDICPCDKASFVKDFNNRLIEILGEETT
KKTLDNHRTEIAGKLFGMFYEDDEVIFPSGRTNKYIEDSDQPAFFKDICFKFQFPNGMDK
LDKVIEKVGAKIQIRQFPYILQVLLTADNNNIQLSKDDIAYYVLNSLQVLQGKIKPIEVI
EKIIEDRSNDITKKVRHPGKETSYSMQHIREQLNYLELANLIRIDGNLVKLNYREAENIN
YIAQFWGNKPEFNAYKYDFTSEDDKKSFFKDWQ
Structures of the domain A3FMN7 2-274
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2vla X-ray 1.3 A 2-274  H-Bb H-Mj L-Bb L-Mj L-Mn 
5hlt X-ray 2.67 B 3-274  H-Bb H-Mj L-Bb L-Mj L-Mn 
5hlt X-ray 2.67 A 3-274  H-Bb H-Mj L-Bb L-Mj 
5hnf X-ray 1.55 A 3-274  H-Bb H-Mj L-Bb L-Mj L-Mn 
5hnh X-ray 1.88 A 3-274  H-Bb H-Mj L-Bb L-Mj L-Mn 


© NPIDB team 2003 - 2021

text