Pfam domain
Pfam family: Ribosomal_S7 (PF00177.20)
Uniprot AC: A4HV05
RecName: 40S ribosomal protein S5
Begin-End: 38-190
Organism: Leishmania infantum
Interaction Mode:   

Sequence:
TSGRWQKRRFHKARMPIVERLANGLMFKGRGNGRKLQAARLLKHTLEIIHLLTDENPLQV
VVDAVSKGAPREDSTRVGSGGVVRRQAVDVSPMRRVNEAIYQMCKGAREAAFRNLKSMPE
CLADEIVNASKGSSNSYAIKKKDEVERVAKANR
Structures of the domain A4HV05 38-190
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6az1 X-ray 2.7 H 49-190 None


© NPIDB team 2003 - 2019

text