Pfam domain
Pfam family: Ribosomal_S2 (PF00318.19)
Uniprot AC: A4IDS4
RecName: 40S ribosomal protein SA
Begin-End: 114-187
Organism: Leishmania infantum
Interaction Mode:   

Sequence:
QIQKKFVQPRVLVVTDPRTDHQAIREASLVNIPVIALCDTDAPLEYVDIAIPCNNRGIKS
IGMMYWLLAREVLR
Structures of the domain A4IDS4 114-187
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6az1 X-ray 2.7 B 115-185 None


© NPIDB team 2003 - 2019

text