Pfam domain
Pfam family: Piwi (PF02171.16)
Uniprot AC: A4WYU7
RecName: Uncharacterized protein
Begin-End: 455-756
Organism: Rhodobacter sphaeroides
Interaction Mode:   

Sequence:
RLPDDRNPYIHTKSLLLTLGVPTQQVRMPTVLLEPKSLQYTLQNFSIATYAKLNGTPWTV
NHDKAINDELVVGMGLAELSGSRTEKRQRFVGITTVFAGDGSYLLGNVSKECEYEGYSDA
IRESMTGILRELKKRNNWRPGDTVRVVFHAHRPLKRVDVASIVFECTREIGSDQNIQMAF
VTVSHDHPFVLIDRSERGLEAYKGSTARKGVFAPPRGAISRVGRLTRLLAVNSPQLIKRA
NTPLPTPLLVSLHPDSTFKDVDYLAEQALKFTSLSWRSTLPAATPVTIFYSERIAELLGR
LK
Structures of the domain A4WYU7 455-756
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5awh X-ray 2 A 466-753 None
5awh X-ray 2 B 466-753 None


© NPIDB team 2003 - 2020

text