Pfam domain
Pfam family: LAGLIDADG_1 (PF00961.18)
Uniprot AC: A5J036
RecName: LAGLIDADG endonuclease
Begin-End: 60-156
Organism: Gibberella zeae
Interaction Mode:  H-Bb S-Bb S-Mj L-Bb L-Mj 

Sequence:
VTGFTDAEGSFMIHLEKNKDKWRVRPTFQIKLDIRDLSLLEEIKIYFNNTGSINTSNKEC
VYKVRSLKDISIIISHFDKYNLITQKKADFELFKLII
Structures of the domain A5J036 60-156
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4z1x X-ray 2.8 B 13-107  H-Bb S-Bb S-Mj L-Bb L-Mj 
4z1x X-ray 2.8 A 13-107  S-Bb S-Mj L-Bb L-Mj 
4efj X-ray 2.8 B 13-107  H-Bb S-Bb S-Mj L-Bb L-Mj 
4efj X-ray 2.8 A 13-107  H-Bb S-Bb S-Mj L-Bb L-Mj 


© NPIDB team 2003 - 2020

text