Pfam domain
Pfam family: RNA_pol_Rpb2_7 (PF04560.19)
Uniprot AC: A5PJW8
RecName: DNA-directed RNA polymerase subunit beta
Begin-End: 1082-1174
Organism: Bos taurus
Interaction Mode:   

Sequence:
GGLRFGEMERDCQIAHGAAQFLRERLFEASDPYQVHVCNLCGIMAIANTRTHTYECRGCR
NKTQISLVRMPYACKLLFQELMSMSIAPRMMSV
Structures of the domain A5PJW8 1082-1174
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5oik X-ray 3.7 B 1082-1172 None
5flm X-ray 3.4 B 1082-1172 None


© NPIDB team 2003 - 2019

text