Pfam domain
Pfam family: RNA_pol_Rpb2_2 (PF04561.13)
Uniprot AC: A5PJW8
RecName: DNA-directed RNA polymerase subunit beta
Begin-End: 201-394
Organism: Bos taurus
Interaction Mode:   

Sequence:
ATNTVYVFAKKDSKYAYTGECRSCLENSSRPTSTIWVSMLARGGQGAKKSAIGQRIVATL
PYIKQEVPIIIVFRALGFVSDRDILEHIIYDFEDPEMMEMVKPSLDEAFVIQEQNVALNF
IGSRGAKPGVTKEKRIKYAKEVLQKEMLPHVGVSDFCETKKAYFLGYMVHRLLLAALGRR
ELDDRDHYGNKRLD
Structures of the domain A5PJW8 201-394
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5oik X-ray 3.7 B 201-394 None
5flm X-ray 3.4 B 201-394 None


© NPIDB team 2003 - 2019

text