Pfam domain
Pfam family: RNA_pol_Rpb2_1 (PF04563.14)
Uniprot AC: A5PJW8
RecName: DNA-directed RNA polymerase subunit beta
Begin-End: 38-442
Organism: Bos taurus
Interaction Mode:  L-Bb 

Sequence:
GLVRQQLDSFDEFIQMSVQRIVEDAPPIDLQAEAQHASGEVEEPPRYLLKFEQIYLSKPT
HWERDGAPSPMMPNEARLRNLTYSAPLYVDITKTVIKEGEEQLQTQHQKTFIGKIPIMLR
STYCLLNGLTDRDLCELNECPLDPGGYFIINGSEKVLIAQEKMATNTVYVFAKKDSKYAY
TGECRSCLENSSRPTSTIWVSMLARGGQGAKKSAIGQRIVATLPYIKQEVPIIIVFRALG
FVSDRDILEHIIYDFEDPEMMEMVKPSLDEAFVIQEQNVALNFIGSRGAKPGVTKEKRIK
YAKEVLQKEMLPHVGVSDFCETKKAYFLGYMVHRLLLAALGRRELDDRDHYGNKRLDLAG
PLLAFLFRGMFKNLLKEVRIYAQKFIDRGKDFNLELAIKTRIISD
Structures of the domain A5PJW8 38-442
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5oik X-ray 3.7 B 38-441  L-Bb 
5flm X-ray 3.4 B 38-441 None


© NPIDB team 2003 - 2019

text