Pfam domain
Pfam family: RNA_pol_Rpb2_6 (PF00562.27)
Uniprot AC: A5PJW8
RecName: DNA-directed RNA polymerase subunit beta
Begin-End: 707-1080
Organism: Bos taurus
Interaction Mode:   

Sequence:
CASIIPFPDHNQSPRNTYQSAMGKQAMGVYITNFHVRMDTLAHVLYYPQKPLVTTRSMEY
LRFRELPAGINSIVAIASYTGYNQEDSVIMNRSAVDRGFFRSVFYRSYKEQESKKGFDQE
EVFEKPTRETCQGMRHAIYDKLDDDGLIAPGVRVSGDDVIIGKTVTLPENEDELEGTNRR
YTKRDCSTFLRTSETGIVDQVMVTLNQEGYKFCKIRVRSVRIPQIGDKFASRHGQKGTCG
IQYRQEDMPFTCEGITPDIIINPHAIPSRMTIGHLIECLQGKVSANKGEIGDATPFNDAV
NVQKISNLLSDYGYHLRGNEVLYNGFTGRKITSQIFIGPTYYQRLKHMVDDKIHSRARGP
IQILNRQPMEGRSR
Structures of the domain A5PJW8 707-1080
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5oik X-ray 3.7 B 707-1080 None
5flm X-ray 3.4 B 707-1080 None


© NPIDB team 2003 - 2019

text