Pfam domain
Pfam family: Bac_DnaA_C (PF08299.13)
Uniprot AC: A5TY69
RecName: Chromosomal replication initiator protein DnaA
Begin-End: 413-480
Organism: Mycobacterium tuberculosis
Interaction Mode:  H-Bb H-Mj L-Bb L-Mj L-Mn 

Sequence:
AATIMAATAEYFDTTVEELRGPGKTRALAQSRQIAMYLCRELTDLSLPKIGQAFGRDHTT
VMYAQRKI
Structures of the domain A5TY69 413-480
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3pvp X-ray 2.3 B 413-480  H-Bb H-Mj L-Bb L-Mj L-Mn 
3pvp X-ray 2.3 A 413-480  H-Bb H-Mj L-Bb L-Mj L-Mn 
3pvv X-ray 2 A 413-480  H-Bb H-Mj L-Bb L-Mj L-Mn 
3pvv X-ray 2 B 413-480  H-Bb H-Mj L-Bb L-Mj L-Mn 


© NPIDB team 2003 - 2021

text