Pfam domain
Pfam family: Myb_DNA-bind_7 (PF15963.4)
Uniprot AC: A6H8Y1
RecName: Transcription factor TFIIIB component B'' homolog
Begin-End: 293-382
Organism: Homo sapiens
Interaction Mode:  H-Bb L-Bb 

Sequence:
SFRKNYYSKPWSNKETDMFFLAISMVGTDFSMIGQLFPHRARIEIKNKFKREEKTNGWRI
DKAFQEKRPFDFDFFAHLLQKVLAEEEKRK
Structures of the domain A6H8Y1 293-382
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5n9g X-ray 2.7 C 293-379  H-Bb L-Bb 
5n9g X-ray 2.7 H 293-379  H-Bb L-Bb 


© NPIDB team 2003 - 2019

text