Pfam domain
Pfam family: Ribosomal_L1 (PF00687.20)
Uniprot AC: A6QPQ5
RecName: 39S ribosomal protein L1, mitochondrial
Begin-End: 123-301
Organism: Bos taurus
Interaction Mode:   

Sequence:
LDLTLDMTLGKKKKVEPFASVLSLPYPFISEMSKVAVFTGNASEIKIAEENGAAFAGGTN
LIQKILDDEIQADFYIAVPEIMPELNPLRKKLKTRFPKFNRNSVGRDIPKMLELFKTGLE
IKVDEERENFLETKIATLDMPSDQIAANLQAVINEVCRQRPLNLGPFVVRAFLRSSTSE
Structures of the domain A6QPQ5 123-301
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2ftc X-ray 12.1 A 12-178 None


© NPIDB team 2003 - 2019

text