Pfam domain
Pfam family: PCNA_N (PF00705.17)
Uniprot AC: A6ZL36
RecName: Proliferating cell nuclear antigen
Begin-End: 2-126
Organism: Saccharomyces cerevisiae
Interaction Mode:  L-Bb 

Sequence:
LEAKFEEASLFKRIIDGFKDCVQLVNFQCKEDGIIAQAVDDSRVLLVSLEIGVEAFQEYR
CDHPVTLGMDLTSLSKILRCGNNTDTLTLIADNTPDSIILLFEDTKKDRIAEYSLKLMDI
DADFL
Structures of the domain A6ZL36 2-126
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3k4x X-ray 2.98 A 536-658 None
3k4x X-ray 2.98 A 269-391  L-Bb 
3k4x X-ray 2.98 A 2-124 None


© NPIDB team 2003 - 2019

text