Pfam domain
Pfam family: LSM (PF01423.21)
Uniprot AC: A6ZYX7
RecName: U6 snRNA-associated Sm-like protein LSm6
Begin-End: 14-83
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
EFLSDIIGKTVNVKLASGLLYSGRLESIDGFMNVALSSATEHYESNNNKLLNKFNSDVFL
RGTQVMYISE
Structures of the domain A6ZYX7 14-83
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6aso X-ray 2.71 F 14-82 None


© NPIDB team 2003 - 2019

text