Pfam domain
Pfam family: eIF3g (PF12353.7)
Uniprot AC: A6ZZ25
RecName: Eukaryotic translation initiation factor 3 subunit G
Begin-End: 45-96
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
VHKSVAERKNWHKYGSEKGSPAGPSAVTARLGEEVELRLSRNWKQAEEERIQ
Structures of the domain A6ZZ25 45-96
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3jaq X-ray 6 s 45-92 None
3jap X-ray 4.9 s 45-92 None


© NPIDB team 2003 - 2020

text