Pfam domain
Pfam family: RNA_pol_Rpb2_7 (PF04560.19)
Uniprot AC: A7ZUK1
RecName: DNA-directed RNA polymerase subunit beta
Begin-End: 1266-1342
Organism: Escherichia coli O139:H28
Interaction Mode:   

Sequence:
GGQRFGEMEVWALEAYGAAYTLQEMLTVKSDDVNGRTKMYKNIVDGNHQMEPGMPESFNV
LLKEIRSLGINIELEDE
Structures of the domain A7ZUK1 1266-1342
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4ylo X-ray 6 C 1266-1340 None
4ylo X-ray 6 I 1266-1340 None
4ylo X-ray 6 O 1266-1340 None
4yln X-ray 5.5 O 1266-1340 None
4yln X-ray 5.5 C 1266-1340 None
4yln X-ray 5.5 I 1266-1340 None


© NPIDB team 2003 - 2019

text