Pfam domain
Pfam family: RNA_pol_Rpb2_3 (PF04565.15)
Uniprot AC: A7ZUK1
RecName: DNA-directed RNA polymerase subunit beta
Begin-End: 513-581
Organism: Escherichia coli O139:H28
Interaction Mode:   

Sequence:
QFMDQNNPLSEITHKRRISALGPGGLTRERAGFEVRDVHPTHYGRVCPIETPEGPNIGLI
NSLSVYAQT
Structures of the domain A7ZUK1 513-581
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4ylo X-ray 6 C 513-580 None
4ylo X-ray 6 I 513-580 None
4ylo X-ray 6 O 513-580 None
4yln X-ray 5.5 O 513-580 None
4yln X-ray 5.5 C 513-580 None
4yln X-ray 5.5 I 513-580 None


© NPIDB team 2003 - 2020

text