Pfam domain
Pfam family: RNA_pol_Rpb1_5 (PF04998.16)
Uniprot AC: A7ZUK2
RecName: DNA-directed RNA polymerase subunit beta'
Begin-End: 766-1317
Organism: Escherichia coli O139:H28
Interaction Mode:   

Sequence:
GLNVLQYFISTHGARKGLADTALKTANSGYLTRRLVDVAQDLVVTEDDCGTHEGIMMTPV
IEGGDVKEPLRDRVLGRVTAEDVLKPGTADILVPRNTLLHEQWCDLLEENSVDAVKVRSV
VSCDTDFGVCAHCYGRDLARGHIINKGEAIGVIAAQSIGEPGTQLTMRTFHIGGAASRAA
AESSIQVKNKGSIKLSNVKSVVNSSGKLVITSRNTELKLIDEFGRTKESYKVPYGAVLAK
GDGEQVAGGETVANWDPHTMPVITEVSGFVRFTDMIDGQTITRQTDELTGLSSLVVLDSA
ERTAGGKDLRPALKIVDAQGNDVLIPGTDMPAQYFLPGKAIVQLEDGVQISSGDTLARIP
QESGGTKDITGGLPRVADLFEARRPKEPAILAEISGIVSFGKETKGKRRLVITPVDGSDP
YEEMIPKWRQLNVFEGERVERGDVISDGPEAPHDILRLRGVHAVTRYIVNEVQDVYRLQG
VKINDKHIEVIVRQMLRKATIVNAGSSDFLEGEQVEYSRVKIANRELEANGKVGATYSRD
LLGITKASLATE
Structures of the domain A7ZUK2 766-1317
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4yln X-ray 5.5 P 766-1315 None
4yln X-ray 5.5 D 766-1315 None
4yln X-ray 5.5 J 766-1315 None


© NPIDB team 2003 - 2020

text