Pfam domain
Pfam family: Methyltransf_4 (PF02390.16)
Uniprot AC: A8C927
RecName: 16S rRNA (adenine(1408)-N(1))-methyltransferase
Begin-End: 25-107
Organism: Escherichia coli
Interaction Mode:   

Sequence:
DRVHIDLGTGDGRNIYKLAINDQNTFYIGIDPVKENLFDISKKIIKKPSKGGLSNVVFVI
AAAESLPFELKNIADSISILFPW
Structures of the domain A8C927 25-107
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4ox9 X-ray 3.8 Y 27-106 None


© NPIDB team 2003 - 2019

text