Pfam domain
Pfam family: CENP-X (PF09415.12)
Uniprot AC: A8MT69
RecName: Centromere protein X
Begin-End: 12-81
Organism: Homo sapiens
Interaction Mode:   

Sequence:
KELVSRLLHLHFKDDKTKVSGDALQLMVELLKVFVVEAAVRGVRQAQAEDALRVDVDQLE
KVLPQLLLDF
Structures of the domain A8MT69 12-81
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4ndy X-ray 7 M 12-81  H-Bb H-Mj S-Bb 
4ndy X-ray 7 N 12-81 None
4ndy X-ray 7 U 12-81  H-Bb H-Mj S-Bb 
4ndy X-ray 7 L 12-81  H-Bb S-Bb 
4ndy X-ray 7 V 12-81  H-Bb H-Mj S-Bb 
4ndy X-ray 7 W 12-81 None
4ndy X-ray 7 B 12-81 None
4ndy X-ray 7 X 12-81 None
4ndy X-ray 7 D 12-81 None
4ndy X-ray 7 H 12-81 None
4ne1 X-ray 6.5 B 12-81 None
4ne1 X-ray 6.5 L 12-81  H-Bb S-Bb 
4ne1 X-ray 6.5 M 12-81  H-Mj 
4ne1 X-ray 6.5 N 12-81 None
4ne1 X-ray 6.5 U 12-81  H-Bb S-Bb 
4ne1 X-ray 6.5 V 12-81  H-Bb H-Mj S-Bb 
4ne1 X-ray 6.5 W 12-81 None
4ne1 X-ray 6.5 X 12-81 None
4ne1 X-ray 6.5 D 12-81 None
4ne1 X-ray 6.5 H 12-81 None
4ne1 X-ray 6.5 r 18-87 None
4ne1 X-ray 6.5 q 18-87 None
4ne1 X-ray 6.5 p 5-81  H-Mj S-Bb 
4ne1 X-ray 6.5 o 12-81  H-Bb H-Mj S-Bb 
4ne1 X-ray 6.5 j 18-87 None
4ne1 X-ray 6.5 i 18-87 None
4ne1 X-ray 6.5 h 12-81  H-Bb 
4ne1 X-ray 6.5 d 12-81 None
4ne1 X-ray 6.5 b 12-81 None
4ne1 X-ray 6.5 Z 12-81 None


© NPIDB team 2003 - 2021

text