Pfam domain
Pfam family: Ribosomal_L34 (PF00468.16)
Uniprot AC: A8NN94
RecName: 39S ribosomal protein L34, mitochondrial
Begin-End: 57-94
Organism: Bos taurus
Interaction Mode:   

Sequence:
YQPSNIKRKNKHGWIRRLSTPNGVQVILRRMHKGRKSL
Structures of the domain A8NN94 57-94
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2ftc X-ray 12.1 Q 53-90 None


© NPIDB team 2003 - 2019

text