Pfam domain
Pfam family: tRNA-synt_2d (PF01409.19)
Uniprot AC: B0S4P3
RecName: Pyrrolysyl-tRNA synthetase
Begin-End: 59-282
Organism: Desulfitobacterium hafniense
Interaction Mode:   

Sequence:
RHLEQLRTVKHRPALLELEEKLAKALHQQGFVQVVTPTIITKSALAKMTIGEDHPLFSQV
FWLDGKKCLRPMLAPNLYTLWRELERLWDKPIRIFEIGTCYRKESQGAQHLNEFTMLNLT
ELGTPLEERHQRLEDMARWVLEAAGIREFELVTESSVVYGDTVDVMKGDLELASGAMGPH
FLDEKWEIFDPWVGLGFGLERLLMIREGTQHVQSMARSLSYLDG
Structures of the domain B0S4P3 59-282
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2zni X-ray 3.1 A 70-275 None
2zni X-ray 3.1 B 70-275 None


© NPIDB team 2003 - 2019

text