Pfam domain
Pfam family: RNA_pol_Rpb1_1 (PF04997.14)
Uniprot AC: B2SQQ2
RecName: DNA-directed RNA polymerase subunit beta'
Begin-End: 14-342
Organism: Xanthomonas oryzae pv. oryzae
Interaction Mode:   

Sequence:
TLDFDAIKIALASPDLIRSWSYGEVKKPETINYRTFKPERDGLFCAAIFGPIKDYECLCG
KYKRMKHRGVVCEKCGTEVTLAKVRRERMGHIDLASPVAHIWFLKSLPSRIGLMLDMTLR
DIERVLYFEAYVVTEPGLTPLERRQLLTEEQYLTARQEYNDDFDAAMGAEAVYELLRTID
LQSEMTRLREEIASTGSETKLKRLTKRIKLIEAFLESGNRPEWMVMTVLPVLPPDLRPLV
PLDGGRFATSDLNDLYRRVINRNNRLRRLLELNAPDIIVRNEKRMLQESVDALLDNGRRG
RAITGTNKRPLKSLADMIKGKQGRFRQNL
Structures of the domain B2SQQ2 14-342
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6j9f X-ray 3.95 D 14-342  H-Mj S-Mj L-Mj 
6j9e X-ray 3.41 D 14-342  H-Bb L-Bb L-Mj L-Mn 


© NPIDB team 2003 - 2021

text