Pfam domain
Pfam family: TAL_effector (PF03377.12)
Uniprot AC: B2SU53
RecName: TAL effector protein PthXo1
Begin-End: 169-199
Organism: Xanthomonas oryzae pv. oryzae
Interaction Mode:  H-Bb L-Bb L-Mj 

Sequence:
KPKVGSTVAQHHEALVGHGFTHAHIVALSRH
Structures of the domain B2SU53 169-199
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3ugm X-ray 3 A 934-965  H-Bb L-Bb L-Mj 
3ugm X-ray 3 A 968-999  L-Mj 
3ugm X-ray 3 A 1002-1032  H-Bb 
3ugm X-ray 3 A 730-761  H-Bb L-Mj 
3ugm X-ray 3 A 798-829  H-Bb L-Bb L-Mj 
3ugm X-ray 3 A 900-930  H-Bb L-Bb L-Mj 
3ugm X-ray 3 A 866-897  L-Bb L-Mj 
3ugm X-ray 3 A 832-863  H-Bb 
3ugm X-ray 3 A 662-693 None
3ugm X-ray 3 A 696-727  H-Bb L-Bb L-Mj 
3ugm X-ray 3 A 628-659 None
3ugm X-ray 3 A 594-625  H-Bb L-Bb L-Mj 
3ugm X-ray 3 A 560-591  L-Bb L-Mj 
3ugm X-ray 3 A 526-557  H-Bb L-Bb L-Mj 
3ugm X-ray 3 A 493-523  H-Bb 
3ugm X-ray 3 A 459-490 None
3ugm X-ray 3 A 425-456  H-Bb L-Mj 
3ugm X-ray 3 A 391-422 None
3ugm X-ray 3 A 359-388  H-Bb L-Bb L-Mj 
3ugm X-ray 3 A 323-354  L-Mj 
3ugm X-ray 3 A 289-320  H-Bb L-Bb L-Mj 


© NPIDB team 2003 - 2020

text