Pfam domain
Pfam family: Ribosomal_S9 (PF00380.18)
Uniprot AC: B6KC70
RecName: Ribosomal protein RPS16
Begin-End: 79-211
Organism: Toxoplasma gondii
Interaction Mode:   

Sequence:
GRKKNAVAVALCTQGKGLLRVNGCPLEHLQPEALKVKAFEPLLLLGKERFQDVDIRVRVS
GGGYVAQIYAIRQAIAKAVVAFNQKYVDEATKKEVRDILVAYDRSLIVADPRRCEPKKFG
GPGARARYQKSYR
Structures of the domain B6KC70 79-211
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5xxu X-ray 3.35 Q 16-148 None


© NPIDB team 2003 - 2019

text