Pfam domain
Pfam family: Ribosomal_S9 (PF00380.18)
Uniprot AC: B7MBZ1
RecName: 30S ribosomal protein S9
Begin-End: 10-130
Organism: Escherichia coli O45:K1
Interaction Mode:   

Sequence:
GRRKSSAARVFIKPGNGKIVINQRSLEQYFGRETARMVVRQPLELVDMVEKLDLYITVKG
GGISGQAGAIRHGITRALMEYDESLRSELRKAGFVTRDARQVERKKVGLRKARRRPQFSK
R
Structures of the domain B7MBZ1 10-130
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5uz4 X-ray 5.8 I 9-129 None


© NPIDB team 2003 - 2019

text