Pfam domain
Pfam family: Bac_DNA_binding (PF00216.20)
Uniprot AC: B7MHM1
RecName: Integration host factor subunit beta
Begin-End: 1-91
Organism: Escherichia coli O45:K1
Interaction Mode:  H-Bb S-Bb L-Bb L-Mn 

Sequence:
MTKSELIERLATQQSHIPAKTVEDAVKEMLEHMASTLAQGERIEIRGFGSFSLHYRAPRT
GRNPKTGDKVELEGKYVPHFKPGKELRDRAN
Structures of the domain B7MHM1 1-91
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5wfe X-ray 3.64 L 1-91  H-Bb S-Bb L-Bb L-Mn 


© NPIDB team 2003 - 2019

text