Pfam domain
Pfam family: RNA_pol_Rpb2_7 (PF04560.19)
Uniprot AC: B7MIX3
RecName: DNA-directed RNA polymerase subunit beta
Begin-End: 1266-1342
Organism: Escherichia coli O45:K1
Interaction Mode:   

Sequence:
GGQRFGEMEVWALEAYGAAYTLQEMLTVKSDDVNGRTKMYKNIVDGNHQMEPGMPESFNV
LLKEIRSLGINIELEDE
Structures of the domain B7MIX3 1266-1342
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6b6h X-ray 3.9 C 1266-1340 None


© NPIDB team 2003 - 2019

text