Pfam domain
Pfam family: RNA_pol_Rpb2_1 (PF04563.14)
Uniprot AC: B7MIX3
RecName: DNA-directed RNA polymerase subunit beta
Begin-End: 26-500
Organism: Escherichia coli O45:K1
Interaction Mode:  L-Bb 

Sequence:
YLLSIQLDSFQKFIEQDPEGQYGLEAAFRSVFPIQSYSGNSELQYVSYRLGEPVFDVQEC
QIRGVTYSAPLRVKLRLVIYEREAPEGTVKDIKEQEVYMGEIPLMTDNGTFVINGTERVI
VSQLHRSPGVFFDSDKGKTHSSGKVLYNARIIPYRGSWLDFEFDPKDNLFVRIDRRRKLP
ATIILRALNYTTEQILDLFFEKVIFEIRDNKLQMELVPERLRGETASFDIEANGKVYVEK
GRRITARHIRQLEKDDVKLIEVPVEYIAGKVVAKDYIDESTGELICAANMELSLDLLAKL
SQSGHKRIETLFTNDLDHGPYISETLRVDPTNDRLSALVEIYRMMRPGEPPTREAAESLF
ENLFFSEDRYDLSAVGRMKFNRSLLREEIEGSGILSKDDIIDVMKKLIDIRNGKGEVDDI
DHLGNRRIRSVGEMAENQFRVGLVRVERAVKERLSLGDLDTLMPQDMINAKPISA
Structures of the domain B7MIX3 26-500
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6b6h X-ray 3.9 C 26-500  L-Bb 


© NPIDB team 2003 - 2019

text