Pfam domain
Pfam family: RNA_pol_Rpb2_3 (PF04565.15)
Uniprot AC: B7MIX3
RecName: DNA-directed RNA polymerase subunit beta
Begin-End: 513-581
Organism: Escherichia coli O45:K1
Interaction Mode:  L-Mj 

Sequence:
QFMDQNNPLSEITHKRRISALGPGGLTRERAGFEVRDVHPTHYGRVCPIETPEGPNIGLI
NSLSVYAQT
Structures of the domain B7MIX3 513-581
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6b6h X-ray 3.9 C 513-580  L-Mj 


© NPIDB team 2003 - 2020

text