Pfam domain
Pfam family: Ribosomal_S4 (PF00163.18)
Uniprot AC: B7NZS8
RecName: Ribosomal protein S9 (Predicted)
Begin-End: 9-140
Organism: Oryctolagus cuniculus
Interaction Mode:   

Sequence:
CRKTYVTPRRPFEKSRLDQELKLIGEYGLRNKREVWRVKFTLAKIRKAARELLTLDEKDP
RRLFEGNALLRRLVRIGVLDEGKMKLDYILGLKIEDFLERRLQTQVFKLGLAKSIHHARV
LIRQRHIRVRKQ
Structures of the domain B7NZS8 9-140
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4d5l X-ray 9 J 19-63 None
4kzx X-ray 7.81 J 19-63 None
4kzz X-ray 7.03 J 19-63 None
4kzy X-ray 7.01 J 19-63 None
5k0y X-ray 5.8 K 19-63 None
4d61 X-ray 9 J 6047-6091 None


© NPIDB team 2003 - 2019

text