Pfam domain
Pfam family: HTH_Crp_2 (PF13545.5)
Uniprot AC: B8FW11
RecName: Cyclic nucleotide-binding protein
Begin-End: 151-225
Organism: Desulfitobacterium hafniense
Interaction Mode:  H-Bb H-Mj L-Bb L-Mj 

Sequence:
IRILRLFYELCSSQGKRVGDTYEITMPLSQKSIGEITGVHHVTVSRVLACLKRENILDKK
KNKIIVYNLGELKHL
Structures of the domain B8FW11 151-225
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3e6c X-ray 1.8 C 152-224  H-Bb H-Mj L-Bb L-Mj 


© NPIDB team 2003 - 2019

text