Pfam domain
Pfam family: cNMP_binding (PF00027.28)
Uniprot AC: B8FW11
RecName: Cyclic nucleotide-binding protein
Begin-End: 34-119
Organism: Desulfitobacterium hafniense
Interaction Mode:   

Sequence:
IRDFAKGSAVIMPGEEITSMIFLVEGKIKLDIIFEDGSEKLLYYAGGNSLIGKLYPTGNN
IYATAMEPTRTCWFSEKSLRTVFRTD
Structures of the domain B8FW11 34-119
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3e6c X-ray 1.8 C 35-118 None


© NPIDB team 2003 - 2019

text