Pfam domain
Pfam family: tRNA-synt_1 (PF00133.21)
Uniprot AC: B9JQP8
RecName: Leucine--tRNA ligase
Begin-End: 406-612
Organism: Agrobacterium radiobacter
Interaction Mode:   

Sequence:
KSTQYRLQNWSISRQRYWGCPIPIIHCSECGTIPVAEEQLPILLPDHLISEGSGSPLSRD
ESWMKAKCPQCGGDAARDPDTMDTFVDSSWYFLRYPSPSSPNPIDSSLCNKIAPADVYIG
GIEHATLHLIYSRFITKVLHDLGYIEFDEPFVELYNQGMVNDVHGRKQSKSLGNVTDPSV
VVQEFGADAVRCYLLFKTTYNAPINWE
Structures of the domain B9JQP8 406-612
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5ah5 X-ray 2.1 B 412-611 None
5ah5 X-ray 2.1 A 412-611 None


© NPIDB team 2003 - 2019

text