Pfam domain
Pfam family: Anticodon_1 (PF08264.12)
Uniprot AC: B9JQP8
RecName: Leucine--tRNA ligase
Begin-End: 655-780
Organism: Agrobacterium radiobacter
Interaction Mode:   

Sequence:
DREIARQLQLAIGKVTADVERFHFNAAIAAIMSVTNLLYEKGGKASPTVLAGSLRLLVRL
LAPFAPHISEELWALSGCNSLVAAEPWPTINERLVQAENIVLPVQINGKLIRTMTIPVNL
AEEDIL
Structures of the domain B9JQP8 655-780
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5ah5 X-ray 2.1 B 655-774 None
5ah5 X-ray 2.1 A 655-774 None


© NPIDB team 2003 - 2019

text