Pfam domain
Pfam family: Ribosomal_S4 (PF00163.18)
Uniprot AC: B9PQU8
RecName: 40S ribosomal protein S9, putative
Begin-End: 3-106
Organism: Toxoplasma gondii
Interaction Mode:   

Sequence:
KSYRTYSKTARSPKRPFEKERLDQEMKLLGEYGLKNKREVWRVQYALAKIRSAARELLTL
EEKDPRRVFQGTALLRRMVRLGLLGESEQKLDYVLGLTVAKFLE
Structures of the domain B9PQU8 3-106
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5xxu X-ray 3.35 J 13-62 None


© NPIDB team 2003 - 2019

text