Pfam domain
Pfam family: Ribosomal_S17e (PF00833.17)
Uniprot AC: B9PXH2
RecName: 40s ribosomal protein s17, putative
Begin-End: 2-118
Organism: Toxoplasma gondii
Interaction Mode:   

Sequence:
GRVRTRTVKRAARQIVEKYYAKLTLDFQINKKISEEVAVIPSKRMRNRVAGFVTHLMKRI
QKGPVRGISLKLQEEERERRMDFVPERSEVDVATITVDQDTADMLRALDINLPNVVV
Structures of the domain B9PXH2 2-118
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5xxu X-ray 3.35 R 2-114 None


© NPIDB team 2003 - 2019

text