Pfam domain
Pfam family: Histone (PF00125.23)
Uniprot AC: C0HKE4
RecName: Histone H2A type 1-E
Begin-End: 16-91
Organism: Mus musculus
Interaction Mode:  H-Bb S-Bb L-Bb 

Sequence:
KTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNK
KTRIIPRHLQLAIRND
Structures of the domain C0HKE4 16-91
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5b1m X-ray 2.34 G 18-88  H-Bb S-Bb 
5b1m X-ray 2.34 C 15-88  H-Bb S-Bb L-Bb 
5b1l X-ray 2.35 G 18-88  H-Bb S-Bb L-Bb 
5b1l X-ray 2.35 C 15-88  H-Bb S-Bb L-Bb 


© NPIDB team 2003 - 2019

text