Pfam domain
Pfam family: LAGLIDADG_1 (PF00961.18)
Uniprot AC: C0JWR6
RecName: Site-specific DNA endonuclease I-MsoI
Begin-End: 15-111
Organism: Monomastix sp.
Interaction Mode:  H-Bb S-Bb S-Mj L-Bb L-Mj 

Sequence:
IAGFLDGDGSIYAKLIPRPDYKDIKYQVSLAISFIQRKDKFPYLQDIYDQLGKRGNLRKD
RGDGIADYTIIGSTHLSIILPDLVPYLRIKKKQANRI
Structures of the domain C0JWR6 15-111
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3ko2 X-ray 2.9 B 15-108  H-Bb S-Bb S-Mj L-Bb L-Mj 
3ko2 X-ray 2.9 A 15-108  H-Bb S-Bb S-Mj L-Mj 
3ko2 X-ray 2.9 G 15-108  S-Bb S-Mj L-Bb L-Mj 
3ko2 X-ray 2.9 F 15-108  H-Bb S-Bb S-Mj L-Mj 
1m5x X-ray 2.25 A 15-108  H-Bb S-Bb S-Mj L-Bb L-Mj 
1m5x X-ray 2.25 B 215-308  H-Bb S-Bb S-Mj L-Bb L-Mj 
2fld X-ray 2 A 15-108  H-Bb S-Bb S-Mj L-Mj 
2fld X-ray 2 B 215-308  H-Bb S-Bb S-Mj L-Bb L-Mj 
3fd2 X-ray 2.69 A 218-311  H-Bb S-Bb S-Mj L-Bb L-Mj 
3fd2 X-ray 2.69 A 15-108  H-Bb S-Bb S-Mj L-Bb L-Mj 


© NPIDB team 2003 - 2019

text