Pfam domain
Pfam family: FtsJ (PF01728.18)
Uniprot AC: C0LMU5
RecName: Genome polyprotein
Begin-End: 2544-2714
Organism: Dengue virus 3
Interaction Mode:   

Sequence:
AVSRGSAKLQWFVERNMVIPEGRVIDLGCGRGGWSYYCAGLKKVTEVRGYTKGGPGHEEP
VPMSTYGWNIVKLMSGKDVFYLPPEKCDTLLCDIGESSPSPTVEESRTIRVLKMVEPWLK
NNQFCIKVLNPYMPTVIEHLERLQRKHGGMLVRNPLSRNSTHEMYWISNGT
Structures of the domain C0LMU5 2544-2714
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2xbm X-ray 2.9 B 55-222 None
2xbm X-ray 2.9 D 55-222 None
2xbm X-ray 2.9 C 55-222 None
2xbm X-ray 2.9 A 55-222 None


© NPIDB team 2003 - 2019

text