Pfam domain
Pfam family: DNA_alkylation (PF08713.13)
Uniprot AC: C3K795
RecName: Uncharacterized protein
Begin-End: 103-237
Organism: Pseudomonas fluorescens
Interaction Mode:  H-Bb L-Bb L-Mn 

Sequence:
DFKRSMAALKYFTTFGSAEFAIRHFLLHDFQRTLAVMQAWSQDDNEHVRRLASEGSRPRL
PWSFRLAEVQADPELCASILDHLKADSSLYVRKSVANHLNDITKDHPEWVLSLIEGWNLE
NPHTAWIARHALRSL
Structures of the domain C3K795 103-237
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5vhv X-ray 1.8 A 103-237  H-Bb L-Bb L-Mn 
5vhv X-ray 1.8 B 103-237  H-Bb L-Bb L-Mn 
5vi0 X-ray 2.4 A 110-237 None
5vi0 X-ray 2.4 B 110-237 None


© NPIDB team 2003 - 2021

text