Pfam domain
Pfam family: S1 (PF00575.25)
Uniprot AC: C3SSN7
RecName: Transcription termination/antitermination protein NusA
Begin-End: 131-197
Organism: Escherichia coli
Interaction Mode:   

Sequence:
REHEGEIITGVVKKVNRDNISLDLGNNAEAVILREDMLPRENFRPGDRVRGVLYSVRPEA
RGAQLFV
Structures of the domain C3SSN7 131-197
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6z9s X-ray 4.4 A 131-197 None
6z9p X-ray 3.9 A 131-197 None
7ade X-ray 4.2 A 131-197 None
7adc X-ray 4 A 131-197 None
6z9t X-ray 4.1 A 131-197 None
7add X-ray 4.3 A 131-197 None
7adb X-ray 4.4 A 131-197 None
6z9r X-ray 4.1 A 131-197 None
6z9q X-ray 5.7 A 131-197 None


© NPIDB team 2003 - 2021

text