Pfam domain
Pfam family: KH_5 (PF13184.8)
Uniprot AC: C3SSN7
RecName: Transcription termination/antitermination protein NusA
Begin-End: 230-298
Organism: Escherichia coli
Interaction Mode:   

Sequence:
PGSRAKIAVKTNDKRIDPVGACVGMRGARVQAVSTELGGERIDIVLWDDNPAQFVINAMA
PADVASIVV
Structures of the domain C3SSN7 230-298
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6z9s X-ray 4.4 A 230-298 None
6z9p X-ray 3.9 A 230-298 None
7ade X-ray 4.2 A 230-298 None
7adc X-ray 4 A 230-298 None
6z9t X-ray 4.1 A 230-298 None
7add X-ray 4.3 A 230-298 None
7adb X-ray 4.4 A 230-298 None
6z9r X-ray 4.1 A 230-298 None
6z9q X-ray 5.7 A 230-298 None


© NPIDB team 2003 - 2021

text