Pfam domain
Pfam family: CtsR (PF05848.10)
Uniprot AC: C3W947
RecName: Transcriptional regulator CtsR
Begin-End: 3-74
Organism: Geobacillus stearothermophilus
Interaction Mode:  H-Bb H-Mj S-Bb L-Bb L-Mj L-Mn 

Sequence:
NISDIIEQYLKQVLNMSDQDIVEIKRSEIANKFRCVPSQINYVINTRFTLERGYIVESKR
GGGGYIRIMKVK
Structures of the domain C3W947 3-74
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3h0d X-ray 2.4 B 3-143  H-Bb H-Mj S-Bb L-Bb L-Mj L-Mn 
3h0d X-ray 2.4 A 3-143  H-Bb H-Mj S-Bb L-Bb L-Mj L-Mn 


© NPIDB team 2003 - 2019

text