Pfam domain
Pfam family: RNA_pol_Rpb2_1 (PF04563.14)
Uniprot AC: C4QZQ7
RecName: DNA-directed RNA polymerase subunit beta
Begin-End: 29-448
Organism: Komagataella phaffii
Interaction Mode:   

Sequence:
GLVSQQLDSFDEFMETSIQDLVWEEPRLILDQPAQHTNEKDNINKRYEIRFGKIYLSRPT
MTEADGTTHAMFPQEARLRNLTYSSPVYLDMEKSMFTSIDDEGNPNATLDWQQVHEPIKD
GVEEGNKVHIGKVPIMLRSKFCSLRTLDEVDLYKMKECPYDMGGYFVINGSEKVLIAQER
SAANIVQVFKKAAPSPISHVAEIRSALEKGSRLISTMQIKLYGREDKGTGRTIKATLPYV
KQDIPIVIVFRALGVVPDGEILQHICYDENDWQMLEMLKPCIEEGFVIQDKEVALDFIGR
RGSAALGIRREKRIQYAKDILQKELLPHITQEEGFETRKTFFLGYMVNRLLLCALERKDQ
DDRDHFGKKRLDLAGPLLANLFRILFRKLTREIYRYMQRCIETDRDFNLNLAVKSTTITS
Structures of the domain C4QZQ7 29-448
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5xon X-ray 3.83 B 29-448 None
5xog X-ray 3 B 29-448 None


© NPIDB team 2003 - 2019

text