Pfam domain
Pfam family: RNA_pol_Rpb2_3 (PF04565.15)
Uniprot AC: C4QZQ7
RecName: DNA-directed RNA polymerase subunit beta
Begin-End: 474-538
Organism: Komagataella phaffii
Interaction Mode:   

Sequence:
QVLNRYTYSSTLSHLRRTNTPIGRDGKLAKPRQLHNTHWGLVCPAETPEGQACGLVKNLS
LLSGI
Structures of the domain C4QZQ7 474-538
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5xon X-ray 3.83 B 474-536 None
5xog X-ray 3 B 474-536 None


© NPIDB team 2003 - 2020

text