Pfam domain
Pfam family: RNA_pol_N (PF01194.16)
Uniprot AC: C4R009
RecName: RNA polymerase subunit ABC10-beta, common to RNA polymerases I, II, and III
Begin-End: 1-59
Organism: Komagataella phaffii
Interaction Mode:   

Sequence:
MIIPVRCFSCGKVVGDKWDAYLRLLEEGKQEGDALDELKLKRYCCRRMVLTHVDLIEKF
Structures of the domain C4R009 1-59
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5xon X-ray 3.83 J 1-58 None
5xog X-ray 3 J 1-58 None


© NPIDB team 2003 - 2019

text