Pfam domain
Pfam family: Spt4 (PF06093.12)
Uniprot AC: C4R0E6
RecName: Transcription elongation factor SPT4
Begin-End: 9-87
Organism: Komagataella phaffii
Interaction Mode:   

Sequence:
ERACMLCGIVLPGRVFMQNGCPNCDSVLNLRDSDQATVNECTSSSFEGLVAVGDNEHSWV
AKWLRVDRFQPGLYAVRVD
Structures of the domain C4R0E6 9-87
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5xon X-ray 3.83 V 9-87 None


© NPIDB team 2003 - 2019

text