Pfam domain
Pfam family: TFIIS_M (PF07500.13)
Uniprot AC: C4R2R6
RecName: General transcription elongation factor TFIIS
Begin-End: 123-232
Organism: Komagataella phaffii
Interaction Mode:   

Sequence:
NKTRNGSISAIYTALAMDSDEQPSKIFELVKDIEKQCFKAVNFTVDDTYRNKLRSLIMNL
KNKNNPTLRRSILDHEIIPSKLVTMSAQELAPDSLKKEMEEIYKKNLFDA
Structures of the domain C4R2R6 123-232
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5xon X-ray 3.83 U 123-231 None


© NPIDB team 2003 - 2019

text