Pfam domain
Pfam family: RNA_pol_Rpb1_3 (PF04983.17)
Uniprot AC: C4R4Y0
RecName: DNA-directed RNA polymerase subunit
Begin-End: 511-670
Organism: Komagataella phaffii
Interaction Mode:   

Sequence:
QIVSPQSNKPVMGIVQDTLCGVRKMTLRDTFIEYEQVMNMLFWVPSWDGVVPQPAILKPK
PLWTGKQLLSIAIPSGIHLQRTDGGNSLLSPKDNGMLIVDGKVMFGVVDKKTVGSGGGGL
IHTVMREKGPKICAELFGNIQKVVNYWLLHNGFSIGIGDA
Structures of the domain C4R4Y0 511-670
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5xon X-ray 3.83 A 511-669 None
5xog X-ray 3 A 511-669 None


© NPIDB team 2003 - 2019

text